You have no items in your shopping cart.
Cart summary
Annexin V/ANXA5 Protein, Human, Recombinant (His)
Catalog Number: orb1978975
| Catalog Number | orb1978975 |
|---|---|
| Category | Proteins |
| Description | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. ANXA5 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.8 kDa and the accession number is P08758. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 37.8 kDa (predicted) |
| UniProt ID | P08758 |
| Protein Sequence | AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. ANXA5 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.8 kDa and the accession number is P08758. |
| Expression Region | 2-320 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
Recombinant human Annexin A5/Annexin V/ANXA5 Protein, His Tag [orb1551184]
> 97% by SDS-PAGE.
Recombinant human Annexin A5/Annexin V/ANXA5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp320) of human Annexin A5/Annexin V/ANXA5 (Accession #NP_001145.1) fused with a 6��His Tag at the C-terminus.
100 μg, 50 μg
