Annexin IV/ANXA4 Antibody

• Catalog Number: orb18546
• Category: Antibodies
• Description: Annexin IV/ANXA4 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 35883 MW
• UniProt ID: P09525
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Annexin A4;35-beta calcimedin;Annexin IV;Annexin-4
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HEL cells using anti-ANXA4 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of ANXA4 using anti-ANXA4 antibody.Lane 1:human HepG2 cell; 2:human A549 cell; 3:human THP-1 cell; 4:human Hacat cell; 5:rat stomach tissue; 6:rat lung tissue; 7:mouse stomach tissue; 8:mouse lung tissue.

IHC analysis of ANXA4 using anti-ANXA4 antibody. ANXA4 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of ANXA4 using anti-ANXA4 antibody. ANXA4 was detected in a paraffin-embedded section of human colonic adenom tissue.

IHC analysis of ANXA4 using anti-ANXA4 antibody. ANXA4 was detected in a paraffin-embedded section of human liver cancer tissue.

IHC analysis of ANXA4 using anti-ANXA4 antibody. ANXA4 was detected in a paraffin-embedded section of human placenta tissue.

IHC analysis of ANXA4 using anti-ANXA4 antibody. ANXA4 was detected in a paraffin-embedded section of mouse kidney tissue.

IHC analysis of ANXA4 using anti-ANXA4 antibody. ANXA4 was detected in a paraffin-embedded section of rat kidney tissue.