You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389454 |
---|---|
Category | Antibodies |
Description | Angiopoietin-like 4/ANGPTL4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | ELISA , 0.1-0.5μg/ml, Human, -Western blot, 0.1-0.5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 45214 MW |
UniProt ID | Q9BY76 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Angiopoietin-related protein 4;Angiopoietin-like p Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of ANGPTL4 using anti-ANGPTL4 antibody.Lane 1:recombinant human ANGPTL4 protein 1ng.
WB | |
Hamster | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating