ANAPC11 monoclonal antibody (M01), clone 1B4-1A4

• Catalog Number: orb2291131
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ANAPC11.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B4-1A4
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
• NCBI: AAH00607
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ANAPC11 is approximately 0.03 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-ANAPC11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (31.68 KDa).