You have no items in your shopping cart.
Cart summary
ANAPC10 Recombinant Protein (Human)
Catalog Number: orb2051626
| Catalog Number | orb2051626 |
|---|---|
| Category | Proteins |
| Description | ANAPC10 Recombinant Protein (Human) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 48.1 kDa |
| UniProt ID | Q9UM13 |
| Protein Sequence | TTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR |
| Source | E.coli |
| NCBI | NP_001243635 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | anaphase-promoting complex subunit 10;APC10;cyclos Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human ANAPC10 protein [orb54355]
Greater than 90% as determined by SDS-PAGE.
48.1 kDa
E.coli
20 μg, 100 μg, 1 mgANAPC10 Recombinant Protein (Human) [orb2051624]
Greater than 90% as determined by SDS-PAGE.
48.1 kDa
E.coli
20 μgANAPC10 Recombinant Protein (Human) [orb2051625]
Greater than 90% as determined by SDS-PAGE.
48.1 kDa
E.coli
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
