Amyloid β/A4 Protein Precursor770 (740-770)

• Catalog Number: orb2693308
• Category: Proteins
• Description: Amyloid β/A4 Protein Precursor₇₇₀ (740-770) corresponds to a C-terminal amyloid precursor protein (APP) fragment known as C31. This fragment is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.
• CAS Number: 1802086-24-3
• Purity: ≥95%
• MW: 3717.14
• Formula: C₁₆₂H₂₄₃N₄₅O₅₂S₂
• Target: others
• Protein Sequence: AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
• Note: For research use only
• Expiration Date: 6 months from date of receipt.