AMT purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2296098
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human AMT protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: AMT (AAH07546.1, 1 a.a. ~ 289 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVELPSGPCF
• NCBI: AAH07546
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AMT MaxPab polyclonal antibody. Western Blot analysis of AMT expression in human kidney.

Western Blot analysis of AMT expression in transfected 293T cell line by AMT MaxPab polyclonal antibody. Lane 1: AMT transfected lysate(31.9 KDa). Lane 2: Non-transfected lysate.