You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
AMT MaxPab rabbit polyclonal antibody (D01)
Catalog Number: orb2296097
| Catalog Number | orb2296097 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human AMT protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IP, WB |
| Reactivity | Human |
| Immunogen | AMT (AAH07546.1, 1 a.a. ~ 289 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVELPSGPCF |
| NCBI | AAH07546.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | No additive |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
AMT MaxPab rabbit polyclonal antibody. Western Blot analysis of AMT expression in human kidney.
AMT MaxPab rabbit polyclonal antibody. Western Blot analysis of AMT expression in K-562.
Immunoprecipitation of AMT transfected lysate using anti-AMT MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with AMT MaxPab rabbit polyclonal antibody (D01) (orb2296097).
Western Blot analysis of AMT expression in transfected 293T cell line by AMT MaxPab polyclonal antibody. Lane 1: AMT transfected lysate(31.90 KDa). Lane 2: Non-transfected lysate.
