AMPD2 monoclonal antibody (M09), clone 6A8

• Catalog Number: orb2296106
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AMPD2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6A8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
• NCBI: NP_631895
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AMPD2 monoclonal antibody (M09), clone 6A8. Western Blot analysis of AMPD2 expression in HeLa.

AMPD2 monoclonal antibody (M09), clone 6A8. Western Blot analysis of AMPD2 expression in human kidney.

AMPD2 monoclonal antibody (M09), clone 6A8. Western Blot analysis of AMPD2 expression in human liver.

Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M09), clone 6A8. Lane 1: AMPD2 transfected lysate(92.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).