AMPD2 monoclonal antibody (M01), clone 2F5

• Catalog Number: orb2296111
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AMPD2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F5
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
• NCBI: NP_631895
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in PC-12.

AMPD2 monoclonal antibody (M01), clone 2F5 Western Blot analysis of AMPD2 expression in Hela S3 NE.

AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in NIH/3T3.

AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in Raw 264.7.

Detection limit for recombinant GST tagged AMPD2 is 0.03 ng/ml as a capture antibody.

Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M01), clone 2F5. Lane 1: AMPD2 transfected lysate(92.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).