You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296111 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant AMPD2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F5 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT |
NCBI | NP_631895 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in PC-12.
AMPD2 monoclonal antibody (M01), clone 2F5 Western Blot analysis of AMPD2 expression in Hela S3 NE.
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in NIH/3T3.
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in Raw 264.7.
Detection limit for recombinant GST tagged AMPD2 is 0.03 ng/ml as a capture antibody.
Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M01), clone 2F5. Lane 1: AMPD2 transfected lysate(92.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).