AMH antibody

• Catalog Number: orb433402
• Category: Antibodies
• Description: Mouse monoclonal antibody to AMH
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 44352
• Tested applications: IHC-P
• Reactivity: Human
• Isotype: IgG1
• Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
• Form/Appearance: Concentrated tissue culture supernatant - liquid
• Purity: Con S/N
• Conjugation: Unconjugated
• Target: AMH
• Storage: +4°C, -20°C if preferred
• Buffer/Preservatives: 0.1% sodium azide (NaN3)
• Alternative names: ANTI MULLERIAN HORMONE
• Note: For research use only
• Expiration Date: 12 months from date of receipt.