AMELX monoclonal antibody (M03A), clone 3B5

• Catalog Number: orb2296116
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AMELX.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: AMELX (NP_001133, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
• NCBI: NP_001133
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AMELX monoclonal antibody (M03A), clone 3B5 Western Blot analysis of AMELX expression in A-431.

Western Blot detection against Immunogen (36.63 KDa).