You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296120 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human AMELX protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Reactivity | Human |
Immunogen | AMELX (NP_001133.1, 1 a.a. ~ 191 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
NCBI | NP_001133.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | No additive |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of AMELX transfected lysate using anti-AMELX MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with AMELX purified MaxPab mouse polyclonal antibody (B01P) (orb2296121).
Western Blot analysis of AMELX expression in transfected 293T cell line by AMELX MaxPab polyclonal antibody. Lane 1: AMELX transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate.