ALX3 monoclonal antibody (M01A), clone 1F1

• Catalog Number: orb2296138
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ALX3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgM Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In ascites fluid
• Immunogen: ALX3 (NP_006483, 150 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWAG
• Tested applications: ELISA, WB
• Clone Number: 1F1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006483

Western Blot detection against Immunogen (36.74 KDa).