Cart summary

You have no items in your shopping cart.

    ALKBH1 Antibody

    Catalog Number: orb654308

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb654308
    CategoryAntibodies
    DescriptionALKBH1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human ALKBH1 (YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.25μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW43 kDa
    UniProt IDQ13686
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesNucleic acid dioxygenase ALKBH1; Alkylated DNA rep
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    ALKBH1 Antibody

    Western blot analysis of ALKBH1 using anti-ALKBH1 antibody (orb654308). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Jurkat whole cell lysates, Lane 2: human K562 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ALKBH1 antigen affinity purified polyclonal antibody (Catalog # orb654308) at 0.25 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for ALKBH1 at approximately 43KD. The expected band size for ALKBH1 is at 43KD.

    ALKBH1 Antibody

    IHC analysis of ALKBH1 using anti-ALKBH1 antibody (orb654308). ALKBH1 was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ALKBH1 Antibody (orb654308) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    ALKBH1 Antibody

    IHC analysis of ALKBH1 using anti-ALKBH1 antibody (orb654308). ALKBH1 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ALKBH1 Antibody (orb654308) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    ALKBH1 Antibody

    IHC analysis of ALKBH1 using anti-ALKBH1 antibody (orb654308). ALKBH1 was detected in paraffin-embedded section of human testis cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ALKBH1 Antibody (orb654308) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    ALKBH1 Antibody

    IF analysis of ALKBH1 using anti-ALKBH1 antibody (orb654308). ALKBH1 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-ALKBH1 Antibody (orb654308) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

    ALKBH1 Antibody

    Flow Cytometry analysis of A431 cells using anti-ALKBH1 antibody (orb654308). Overlay histogram showing A431 cells stained with orb654308 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ALKBH1 Antibody (orb654308, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    • ALKBH1 antibody [orb353440]

      ELISA,  IHC

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl, 50 μl
    • ALKBH1 Antibody [orb1257142]

      IP,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      50 μl
    • ALKBH1 Antibody [orb1260103]

      IF,  IP,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      50 μl
    • ALKBH1 antibody [orb519729]

      ELISA,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      50 μl, 100 μl
    • ALKBH1 antibody [orb519730]

      ELISA,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      50 μl, 100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars