You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290726 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ALG2 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Immunogen | ALG2 (NP_149078.1, 1 a.a. ~ 416 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV |
NCBI | NP_149078.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ALG2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in A-431.
ALG2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in human kidney.
Western Blot analysis of ALG2 expression in transfected 293T cell line by ALG2 MaxPab polyclonal antibody. Lane 1: ALG2 transfected lysate(47.10 KDa). Lane 2: Non-transfected lysate.