ALG1 Rabbit Polyclonal Antibody

• Catalog Number: orb580684
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALG1
• Target: ALG1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
• Protein Sequence: Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
• UniProt ID: B4DP08
• MW: 38kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
• Note: For research use only
• NCBI: NP_061982.3

Sample Type: Uterus Tumor lysates, Antibody dilution: 1.0 ug/ml.