You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296185 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ALDH9A1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3C6 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | ALDH9A1 (NP_000687, 173 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMN |
NCBI | NP_000687 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ALDH9A1 monoclonal antibody (M01), clone 3C6. Western Blot analysis of ALDH9A1 expression in HeLa.
ALDH9A1 monoclonal antibody (M01), clone 3C6. Western Blot analysis of ALDH9A1 expression in human liver.
Detection limit for recombinant GST tagged ALDH9A1 is 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ALDH9A1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of ALDH9A1 expression in transfected 293T cell line by ALDH9A1 monoclonal antibody (M01), clone 3C6. Lane 1: ALDH9A1 transfected lysate (Predicted MW: 53.8 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.52 KDa).