ALDH2 Antibody(monoclonal, 6H2)

• Catalog Number: orb614090
• Category: Antibodies
• Description: ALDH2 Antibody(monoclonal, 6H2)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6H2
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
• Dilution range: Western blot, 0.1-0.5 μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 56381
• UniProt ID: P05091
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of SiHa cells using anti-ALDH2 antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.

IF analysis of ALDH2 using anti-ALDH2 antibody.

IF analysis of ALDH2 using anti-ALDH2 antibody.

WB analysis using anti-ALDH2 antibody.Lane 1:rat liver tissue, Lane 2:rat kidney tissue, Lane 3:rat heart tissue, Lane 4:rat PC-12 cell, Lane 5:mouse liver tissue, Lane 6:mouse Ana-1 cell.

WB analysis using anti-ALDH2 antibody.Lane 1:HepG2 cell, Lane 2:placenta tissue, Lane 3:HEK293 cell, Lane 4:HL-60 cell, Lane 5:SHG-44 cell, Lane 6:THP-1 cell, Lane 7:K562 cell.