ALDH2 Antibody (monoclonal, 5G7)

• Catalog Number: orb610912
• Category: Antibodies
• Description: ALDH2 Antibody (monoclonal, 5G7)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5G7
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG2a
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
• Concentration: 0
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 56 kDa
• UniProt ID: P05091
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Aldehyde dehydrogenase, mitochondrial; ALDH class
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

IF analysis of ALDH2 using anti-ALDH2 antibody.

Flow Cytometry analysis of A549 cells using anti-ALDH2 antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.

WB analysis using anti-ALDH2 antibody.Lane 1:rat liver tissue, Lane 2:rat kidney cell, Lane 3:rat heart cell, Lane 4:mouse liver cell, Lane 5:mouse kidney cell