ALDH1L1 polyclonal antibody (A01)

• Catalog Number: orb2291491
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant ALDH1L1.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human
• Immunogen: ALDH1L1 (NP_036322, 803 a.a. ~ 902 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
• NCBI: NP_036322
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (37.11 KDa).

ALDH1L1 polyclonal antibody (A01), Western Blot analysis of ALDH1L1 expression in human liver.