ALAD purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2296219
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ALAD protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: ALAD (NP_000022.2, 1 a.a. ~ 339 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MPLCPLAHAMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE
• NCBI: NP_000022.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ALAD MaxPab rabbit polyclonal antibody. Western Blot analysis of ALAD expression in human liver.

Western Blot analysis of ALAD expression in transfected 293T cell line by ALAD MaxPab polyclonal antibody. Lane 1: ALAD transfected lysate(37.20 KDa). Lane 2: Non-transfected lysate.