AKT2 monoclonal antibody (M06), clone X1

• Catalog Number: orb2296222
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AKT2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: X1
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
• NCBI: AAA58364
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AKT2 monoclonal antibody (M06), clone X1. Western Blot analysis of AKT2 expression in NIH/3T3.

AKT2 monoclonal antibody (M06), clone X1 Western Blot analysis of AKT2 expression in Jurkat.

AKT2 monoclonal antibody (M06), clone X1. Western Blot analysis of AKT2 expression in PC-12.

AKT2 monoclonal antibody (M06), clone X1. Western Blot analysis of AKT2 expression in Raw 264.7.

Detection limit for recombinant GST tagged AKT2 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to AKT2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (35.53 KDa).