AKT2 monoclonal antibody (M05), clone 1F3

• Catalog Number: orb2296223
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AKT2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F3
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
• NCBI: AAA58364
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AKT2 monoclonal antibody (M05), clone 1F3 Western Blot analysis of AKT2 expression in Jurkat.

AKT2 monoclonal antibody (M05), clone 1F3. Western Blot analysis of AKT2 expression in NIH/3T3.

AKT2 monoclonal antibody (M05), clone 1F3. Western Blot analysis of AKT2 expression in PC-12.

AKT2 monoclonal antibody (M05), clone 1F3. Western Blot analysis of AKT2 expression in Raw 264.7.

Detection limit for recombinant GST tagged AKT2 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (35.53 KDa).