AKT2 monoclonal antibody (M04A), clone 1F8

• Catalog Number: orb2296224
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AKT2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In ascites fluid
• Immunogen: AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
• Tested applications: ELISA, WB
• Clone Number: 1F8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAA58364

AKT2 monoclonal antibody (M04A), clone 1F8 Western Blot analysis of AKT2 expression in Jurkat.

AKT2 monoclonal antibody (M04A), clone 1F8. Western Blot analysis of AKT2 expression in NIH/3T3.

AKT2 monoclonal antibody (M04A), clone 1F8. Western Blot analysis of AKT2 expression in PC-12.

AKT2 monoclonal antibody (M04A), clone 1F8. Western Blot analysis of AKT2 expression in Raw 264.7.

Western Blot detection against Immunogen (35.53 KDa).