You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296225 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant AKT2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1D9 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII |
NCBI | AAA58364 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
AKT2 monoclonal antibody (M03), clone 1D9 Western Blot analysis of AKT2 expression in Jurkat.
AKT2 monoclonal antibody (M03), clone 1D9. Western Blot analysis of AKT2 expression in NIH/3T3.
AKT2 monoclonal antibody (M03), clone 1D9. Western Blot analysis of AKT2 expression in PC-12.
AKT2 monoclonal antibody (M03), clone 1D9. Western Blot analysis of AKT2 expression in Raw 264.7.
Detection limit for recombinant GST tagged AKT2 is approximately 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.53 KDa).