AKR1D1 Antibody

• Catalog Number: orb527013
• Category: Antibodies
• Description: AKR1D1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human AKR1D1 (EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Flow Cytometry(Fixed), 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 37 kDa
• UniProt ID: P51857
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: 3-oxo-5-beta-steroid 4-dehydrogenase; Aldo-keto re
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HepG2 cells using anti-AKR1D1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of AKR1D1 using anti-AKR1D1 antibody.Lane 1:human HepG2 cell;2:rat liver tissue;3:mouse liver tissue;4:mouse testis tissue.

IHC analysis of AKR1D1 using anti-AKR1D1 antibody.AKR1D1 was detected in paraffin-embedded section of human liver cancer tissue.

IHC analysis of AKR1D1 using anti-AKR1D1 antibody.AKR1D1 was detected in paraffin-embedded section of rat liver tissue.

IHC analysis of AKR1D1 using anti-AKR1D1 antibody.AKR1D1 was detected in paraffin-embedded section of rat liver tissue.