AKR1C3 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2291855
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human AKR1C3 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: AKR1C3 (-, 1 a.a. ~ 323 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AKR1C3 MaxPab polyclonal antibody. Western Blot analysis of AKR1C3 expression in human liver.

Western Blot analysis of AKR1C3 expression in transfected 293T cell line by AKR1C3 MaxPab polyclonal antibody. Lane 1: AKR1C3 transfected lysate (35.53 KDa). Lane 2: Non-transfected lysate.