AKR1C1 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2293711
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human AKR1C1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: AKR1C1 (NP_001344.2, 1 a.a. ~ 323 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• NCBI: NP_001344.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AKR1C1 MaxPab rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.

Immunoprecipitation of AKR1C1 transfected lysate using anti-AKR1C1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKR1C1 purified MaxPab mouse polyclonal antibody (B01P) (orb2293712).

Western Blot analysis of AKR1C1 expression in transfected 293T cell line by AKR1C1 MaxPab polyclonal antibody. Lane 1: AKR1C1 transfected lysate (36.80 KDa). Lane 2: Non-transfected lysate.