AKR1B10 Antibody

• Catalog Number: orb18528
• Category: Antibodies
• Description: AKR1B10 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 36020 MW
• UniProt ID: O60218
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Aldo-keto reductase family 1 member B10;1.1.1.-;AR
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of AKR1B10 using anti-AKR1B10 antibody.Lane 1:human A549 cell; 2:human HepG2 cell.

IF analysis of AKR1B10 using anti-AKR1B10 antibody. AKR1B10 was detected in an immunocytochemical section of A549 cells.

IHC analysis of AKR1B10 using anti-AKR1B10 antibody. AKR1B10 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of AKR1B10 using anti-AKR1B10 antibody. AKR1B10 was detected in paraffin-embedded section of human liver cancer tissues.