AKR1B1 monoclonal antibody (M03), clone 2D12

• Catalog Number: orb2296167
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant AKR1B1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: AKR1B1 (AAH00260.1, 1 a.a. ~ 316 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 2D12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH00260.1

Detection limit for recombinant GST tagged AKR1B1 is 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to AKR1B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (60.39 KDa).