AKAP10 monoclonal antibody (M04), clone 8C10

• Catalog Number: orb2291423
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AKAP10.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: AKAP10 (NP_009133, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 8C10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_009133

AKAP10 monoclonal antibody (M04), clone 8C10. Western Blot analysis of AKAP10 expression in Raw 264.7.

Detection limit for recombinant GST tagged AKAP10 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to AKAP10 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml]

Western Blot analysis of AKAP10 expression in transfected 293T cell line by AKAP10 monoclonal antibody (M04), clone 8C10. Lane 1: AKAP10 transfected lysate(73.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of AKAP10 over-expressed 293 cell line, cotransfected with AKAP10 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AKAP10 monoclonal antibody (M04), clone 8C10 (Cat # orb2291423). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).