AK3L1 purified MaxPab mouse polyclonal antibody (B02P)

• Catalog Number: orb2296243
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human AK3L1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human
• Immunogen: AK3L1 (NP_001002921, 1 a.a. ~ 223 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
• NCBI: NP_001002921
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AK3L1 MaxPab polyclonal antibody. Western Blot analysis of AK3L1 expression in human liver.

Immunofluorescence of purified MaxPab antibody to AK3L1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of AK3L1 expression in transfected 293T cell line by AK3L1 MaxPab polyclonal antibody. Lane 1: AK3L1 transfected lysate(24.53 KDa). Lane 2: Non-transfected lysate.