AK2 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2296246
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human AK2 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: AK2 (NP_001616.1, 1 a.a. ~ 239 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
• NCBI: NP_001616.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AK2 MaxPab rabbit polyclonal antibody. Western Blot analysis of AK2 expression in human kidney.

AK2 MaxPab rabbit polyclonal antibody. Western Blot analysis of AK2 expression in mouse kidney.

Western Blot analysis of AK2 expression in transfected 293T cell line by AK2 MaxPab polyclonal antibody. Lane 1: AK2 transfected lysate(26.50 KDa). Lane 2: Non-transfected lysate.