AIF/AIFM1 Antibody

• Catalog Number: orb251549
• Category: Antibodies
• Description: AIF/AIFM1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF (582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat Immunocytochemistry, 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 66901 MW
• UniProt ID: O95831
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Apoptosis-inducing factor 1, mitochondrial;1.1.1.-
• Note: For research use only
• Application notes: WB: The detection limit for AIF is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HeLa cells using anti-AIF antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of AIF using anti-AIF antibody.Lane 1:human placenta tissue;2:human A549 cell;3:human PC-3 cell;4:human K562 cell;5:human Caco-2 cell;6:human HeLa cell;7:human HL-60 cell;8:human U-87MG cell.

WB analysis of AIF using anti-AIF antibody.Lane 1:rat spleen tissue;2:rat ovary tissue;3:rat lung tissue;4:rat liver tissue;5:mouse spleen tissue;6:mouse testis tissue;7:mouse lung tissue;8:mouse liver tissue;9:mouse ovary tissue.

IF analysis of AIF using anti-AIF antibody. AIF was detected in immunocytochemical section of NIH3T3 cells.

IF analysis of AIF using anti-AIF antibody. AIF was detected in immunocytochemical section of MCF-7 cells.

IHC analysis of AIF using anti-AIF antibody.AIF was detected in paraffin-embedded section of Mouse Cardiac Muscle Tissue.

IHC analysis of AIF using anti-AIF antibody.AIF was detected in paraffin-embedded section of Rat Cardiac Muscle Tissue.

IHC analysis of AIF using anti-AIF antibody.AIF was detected in paraffin-embedded section of Human Intestinal Cancer Tissue.

IHC analysis of AIF using anti-AIF antibody.AIF was detected in immunocytochemical section of SMMC-7721 Cell.