AHCYL1 monoclonal antibody (M05), clone 5D6

• Catalog Number: orb2291499
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AHCYL1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: AHCYL1 (NP_006612, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 5D6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006612

AHCYL1 monoclonal antibody (M05), clone 5D6 Western Blot analysis of AHCYL1 expression in HeLa.

Detection limit for recombinant GST tagged AHCYL1 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to AHCYL1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

Western Blot analysis of AHCYL1 expression in transfected 293T cell line by AHCYL1 monoclonal antibody (M05), clone 5D6. Lane 1: AHCYL1 transfected lysate(69 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.85 KDa).