You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389383 |
---|---|
Category | Antibodies |
Description | AFF4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat, By Heat Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 127459 MW |
UniProt ID | Q9UHB7 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | AF4/FMR2 family member 4;ALL1-fused gene from chro Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20 mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of SiHa cells using anti-AFF4 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of AFF4 using anti-AFF4 antibody.Lane 1:human HeLa cell; 2:human HepG2 cell; 3:human 293T cell; 4:human U87 cell.
IHC analysis of AFF4 using anti-AFF4 antibody. AFF4 was detected in a paraffin-embedded section of human placenta tissue.
Filter by Rating