You have no items in your shopping cart.
Cart summary
ADTRP Protein, Human, Recombinant (His & Myc)
Catalog Number: orb1978980
| Catalog Number | orb1978980 |
|---|---|
| Category | Proteins |
| Description | ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 31.8 kDa (predicted) |
| UniProt ID | Q96IZ2 |
| Protein Sequence | MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system. |
| Expression Region | 1-230 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
