You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290776 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ADPGK. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1E4 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | ADPGK (NP_112574, 425 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY |
NCBI | NP_112574 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ADPGK monoclonal antibody (M01), clone 1E4 Western Blot analysis of ADPGK expression in HeLa.
ADPGK monoclonal antibody (M01), clone 1E4. Western Blot analysis of ADPGK expression in NIH/3T3.
ADPGK monoclonal antibody (M01), clone 1E4. Western Blot analysis of ADPGK expression in PC-12.
ADPGK monoclonal antibody (M01), clone 1E4. Western Blot analysis of ADPGK expression in Raw 264.7.
Detection limit for recombinant GST tagged ADPGK is 0.3 ng/ml as a capture antibody.
Western Blot analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody (M01), clone 1E4. Lane 1: ADPGK transfected lysate(54.1 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody (M01), clone 1E4 (Cat # orb2290776). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (33.66 KDa).