You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296338 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ADORA2A protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse |
Immunogen | ADORA2A (NP_000666.2, 1 a.a. ~ 412 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS |
NCBI | NP_000666.2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ADORA2A MaxPab rabbit polyclonal antibody. Western Blot analysis of ADORA2A expression in mouse liver.
ADORA2A MaxPab rabbit polyclonal antibody. Western Blot analysis of ADORA2A expression in human pancreas.
Western Blot analysis of ADORA2A expression in transfected 293T cell line by ADORA2A MaxPab polyclonal antibody. Lane 1: ADORA2A transfected lysate(44.70 KDa). Lane 2: Non-transfected lysate.