You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296340 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human ADORA2A protein. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | FC, WB |
Reactivity | Human |
Immunogen | ADORA2A (AAH13780.1, 1 a.a. ~ 412 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS |
NCBI | AAH13780.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
FACS analysis of negative control 293 cells (Black) and ADORA2A expressing 293 cells (Green) using ADORA2A purified MaxPab mouse polyclonal antibody.
ADORA2A MaxPab polyclonal antibody. Western Blot analysis of ADORA2A expression in HeLa.
Western Blot analysis of ADORA2A expression in transfected 293T cell line by ADORA2A MaxPab polyclonal antibody. Lane 1: ADORA2A transfected lysate(45.43 KDa). Lane 2: Non-transfected lysate.