You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296337 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ADORA2A. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ADORA2A (NP_000666.2, 147 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | GQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPL |
Tested applications | ELISA, IP, WB |
Clone Number | 4E4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000666.2 |
Immunoprecipitation of ADORA2A transfected lysate using anti-ADORA2A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ADORA2A MaxPab rabbit polyclonal antibody.
Detection limit for recombinant GST tagged ADORA2A is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.94 KDa).