ADORA2A monoclonal antibody (M17), clone 4E4

• Catalog Number: orb2296337
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ADORA2A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E4
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ADORA2A (NP_000666.2, 147 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPL
• NCBI: NP_000666.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of ADORA2A transfected lysate using anti-ADORA2A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ADORA2A MaxPab rabbit polyclonal antibody.

Detection limit for recombinant GST tagged ADORA2A is 1 ng/ml as a capture antibody.

Western Blot detection against Immunogen (38.94 KDa).