You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296355 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ADH4. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1D2 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | ADH4 (NP_000661, 52 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS |
NCBI | NP_000661 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In ascites fluid |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ADH4 monoclonal antibody (M03A), clone 1D2. Western Blot analysis of ADH4 expression in human liver.
ADH4 monoclonal antibody (M03A), clone 1D2. Western Blot analysis of ADH4 expression in Hela S3 NE.
Western Blot detection against Immunogen (36.63 KDa).