ADH4 monoclonal antibody (M01), clone 3C5

• Catalog Number: orb2296356
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ADH4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ADH4 (NP_000661, 52 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS
• NCBI: NP_000661
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of ADH4 expression in transfected 293T cell line by ADH4 monoclonal antibody (M01), clone 3C5. Lane 1: ADH4 transfected lysate(40.2 KDa). Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged ADH4 is approximately 0.3 ng/ml as a capture antibody.

Western blot analysis of ADH4 over-expressed 293 cell line, cotransfected with ADH4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ADH4 monoclonal antibody (M01), clone 3C5. GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).