You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296368 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a partial recombinant ADD3. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | 50 % glycerol |
Immunogen | ADD3 (NP_058432, 462 a.a. ~ 560 a.a) partial recombinant protein with GST tag. |
Protein Sequence | PRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG |
Tested applications | ELISA, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_058432 |
ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in K-562.
ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in Raw 264.7.
ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in NIH/3T3.
ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in PC-12.
Western Blot detection against Immunogen (37 KDa).