ACYP1 monoclonal antibody (M01), clone S3

• Catalog Number: orb2296392
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ACYP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: ACYP1 (AAH35568, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
• NCBI: AAH35568
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of ACYP1 expression in transfected 293T cell line by ACYP1 monoclonal antibody (M01), clone 1B2-3A2. Lane 1: ACYP1 transfected lysate(11.3 KDa). Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged ACYP1 is approximately 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.63 KDa).