You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296395 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ACY1 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse |
Immunogen | ACY1 (NP_000657.1, 1 a.a. ~ 408 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS |
NCBI | NP_000657.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in human liver.
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in mouse liver.
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in MCF-7.
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in NIH/3T3.
Western Blot analysis of ACY1 expression in transfected 293T cell line by ACY1 MaxPab polyclonal antibody. Lane 1: ACY1 transfected lysate(45.90 KDa). Lane 2: Non-transfected lysate.