You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296393 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant ACY1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1A11-F6 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS |
NCBI | AAH00545 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot analysis of ACY1 expression in transfected 293T cell line by ACY1 monoclonal antibody (M02), clone 1A11-F6. Lane 1: ACY1 transfected lysate (Predicted MW: 45.9 KDa). Lane 2: Non-transfected lysate.
Immunoprecipitation of ACY1 transfected lysate using anti-ACY1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACY1 MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (70.62 KDa).