ACY1 monoclonal antibody (M02), clone 1A11-F6

• Catalog Number: orb2296393
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant ACY1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A11-F6
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
• NCBI: AAH00545
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of ACY1 expression in transfected 293T cell line by ACY1 monoclonal antibody (M02), clone 1A11-F6. Lane 1: ACY1 transfected lysate (Predicted MW: 45.9 KDa). Lane 2: Non-transfected lysate.

Immunoprecipitation of ACY1 transfected lysate using anti-ACY1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACY1 MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (70.62 KDa).