You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296410 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ACVR1B. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1C1 |
Tested applications | ELISA, PLA, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE |
NCBI | AAH00254 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot analysis of ACVR1B expression in transfected 293T cell line by ACVR1B monoclonal antibody (M09), clone 1C1. Lane 1: ACVR1B transfected lysate (Predicted MW: 56.8 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged ACVR1B is approximately 0.03 ng/ml as a capture antibody.
Proximity Ligation Analysis of protein-protein interactions between XIAP and ACVR1B. HeLa cells were stained with anti-XIAP rabbit purified polyclonal 1:1200 and anti-ACVR1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.96 KDa).