ACVR1 monoclonal antibody (M07), clone 2D5

• Catalog Number: orb2296417
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ACVR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ACVR1 (AAH33867, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
• NCBI: AAH33867
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of ACVR1 expression in transfected 293T cell line by ACVR1 monoclonal antibody (M07), clone 2D5. Lane 1: ACVR1 transfected lysate (Predicted MW: 57.2 KDa). Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged ACVR1 is 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.63 KDa).